PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01635s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 552aa    MW: 62644.9 Da    PI: 9.6576
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01635s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.53.5e-11553856
                    -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    ++ q+++Le+++ +++yp+ +e+e++ k+lg t + V+ WF+ rR + k
  Csa01635s010.1  5 SPVQVQALEAFYFEQMYPTPKEMEDMGKSLGFTVKEVSGWFKRRRSRGK 53
                    788*******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.2E-7159IPR001356Homeobox domain
PROSITE profilePS5007112.05155IPR001356Homeobox domain
SuperFamilySSF466896.84E-10356IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-10354IPR009057Homeodomain-like
CDDcd000861.67E-8351No hitNo description
PfamPF000461.0E-8553IPR001356Homeobox domain
SMARTSM005711.0E-6349414IPR018501DDT domain
PROSITE profilePS508279.797355414IPR018501DDT domain
PfamPF027915.7E-8363409IPR018501DDT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MKRKSPVQVQ ALEAFYFEQM YPTPKEMEDM GKSLGFTVKE VSGWFKRRRS RGKGMISPAD  60
DVVGAGNPQS YNTSRIRSSR CDFRAGVKKR SSVETRKANC QELFTSQHIL AKIFRKDGPP  120
LGSEFDHLSS GARKASWLGT SSVEQQKQRM TRKRKISELM DHTSQDCVQE NATVMKHGIG  180
KGLMTVWRVM NPNRRDVSPC VGLLDERATL PQSSARNPPH QKKKQSQLAS ILKQKLLQKR  240
STEKKRRSIN REVELNKDET QREFKENCEL AVDREVFKET CQTTSILVDD EELEMRERQE  300
RGNPLTCSCH HSSSGSHGCF LCKDLLPKFP PNSVQMRVPF GLHPWNSFPE TVKKLFKVLL  360
SWQVVHFLYT YSVTLDICPF TLDEFTRAFH DKDSLLLGKI HLSLLKLLLL DVETELQRGS  420
FSNLSISCKF LALLQSVESQ ILILDLWKDS LNSLTWTEIL RQILVAAGYG SVKGAVQSEE  480
LSKERRLMKN YGLHIGTLKG ELFRVLNKQG NNGLKISELA NSPEVAGLNL ATAQEEQENS  540
ICSTLASDIT LF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0496401e-110AL049640.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T20K18 (ESSA project).
GenBankAL1615341e-110AL161534.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 34.
GenBankCP0026871e-110CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010497108.10.0PREDICTED: uncharacterized protein LOC104774140, partial
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLR0GUF40.0R0GUF4_9BRAS; Uncharacterized protein
STRINGAT4G12750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96382125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator